PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07374A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 336aa    MW: 35666.4 Da    PI: 10.4977
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07374AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-15128172347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  Oropetium_20150105_07374A 128 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 172
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129420.171121177IPR017930Myb domain
SuperFamilySSF466893.66E-18122178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-18124176IPR006447Myb domain, plants
SMARTSM007171.5E-11125175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-11125171IPR009057Homeodomain-like
CDDcd001677.68E-10128173No hitNo description
PfamPF002492.9E-12128172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCSG PQRSLETNNG VCGGGGVRLF GVQLHVVGSS SVPSPMKKCF  60
SMECLSSSAP AYYAAALAAA GARXXXXXXX XXXXXVSVDE AAAEKVTNGY LSDGLMGSRA  120
QERKKGVPWT EDEHRRFLAG LEKLGKGDWR GISRHFVTTR TPTQVASHAQ KYFLRQSSLT  180
QKKRRTSLFD VVENSEKALS CVSGGRGARL RDETSTMSET EFPALSLGIS SSSSRATKPE  240
HALPPSLLLA LTTPPPRCSA AMSTSPPHLV APRHHPSSLS LTTTTSKPPA AITSLRAPPP  300
PDLELKISTA AARQTTDQAG PSPRTPPFFG TIRVT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455021.11e-104hypothetical protein SORBIDRAFT_03g003100
TrEMBLA0A0A9ESZ51e-126A0A0A9ESZ5_ARUDO; Uncharacterized protein
STRINGSb03g003100.11e-104(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.18e-43MYB_related family protein